Loading...
Statistics
Advertisement

荆门市国韵琴行
www.jmgyqh.com/
荆门市国韵琴行

Jmgyqh.com

Advertisement
Conversion Technology Metas Server
Jmgyqh.com is hosted in Hong Kong / Central District . Jmgyqh.com doesn't use HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Html, Javascript, Number of used javascripts: 1. First javascripts: Js.js, Number of used analytics tools: 0. Its server type is: IIS.

Technologies in use by Jmgyqh.com

Technology

Number of occurences: 5
  • CSS
  • Html
  • Javascript
  • Php
  • Swf Object

Advertisement

Javascripts

Number of occurences: 1
  • js.js

Server Type

  • IIS

Powered by

  • WAF/2.0

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Jmgyqh.com

Missing HTTPS protocol.

    Meta - Jmgyqh.com

    Number of occurences: 3
    • Name:
      Content: IE=7
    • Name: Keywords
      Content: 荆门市国韵琴行
    • Name: Description
      Content: 荆门市国韵琴行

    Server / Hosting

    • IP: 113.10.178.38
    • Latitude: 22.29
    • Longitude: 114.15
    • Country: Hong Kong
    • City: Central District

    Target

    • hostmaster.nameserver

    HTTP Header Response

    HTTP/1.1 200 OK Cache-Control: private Content-Type: text/html Set-Cookie: ASPSESSIONIDACADTQQD=KDIFCEJBFAEBLIPIIGHLGFAC; path=/ Server: IIS X-Powered-By: WAF/2.0 Date: Fri, 09 Sep 2016 21:26:50 GMT X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Transfer-Encoding: chunked Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive

    DNS

    host: jmgyqh.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 113.10.178.38
    host: jmgyqh.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname:
    5. rname: hostmaster.nameserver
    6. serial: 7
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 5

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.mgyqh.com, www.jzmgyqh.com, www.zmgyqh.com, www.jhmgyqh.com, www.hmgyqh.com, www.jnmgyqh.com, www.nmgyqh.com, www.j.mgyqh.com, www..mgyqh.com, www.jumgyqh.com, www.umgyqh.com, www.jkmgyqh.com, www.kmgyqh.com, www.jlmgyqh.com, www.lmgyqh.com, www.jomgyqh.com, www.omgyqh.com, www.jgyqh.com, www.jmpgyqh.com, www.jpgyqh.com, www.jmogyqh.com, www.jogyqh.com, www.jmigyqh.com, www.jigyqh.com, www.jmkgyqh.com, www.jkgyqh.com, www.jm.gyqh.com, www.j.gyqh.com, www.jmugyqh.com, www.jugyqh.com, www.jmjgyqh.com, www.jjgyqh.com, www.jmngyqh.com, www.jngyqh.com, www.jm-gyqh.com, www.j-gyqh.com, www.jmyqh.com, www.jmgsyqh.com, www.jmsyqh.com, www.jmgxyqh.com, www.jmxyqh.com, www.jmgyyqh.com, www.jmyyqh.com, www.jmghyqh.com, www.jmhyqh.com, www.jmgnyqh.com, www.jmnyqh.com, www.jmgcyqh.com, www.jmcyqh.com, www.jmgdyqh.com, www.jmdyqh.com, www.jmgeyqh.com, www.jmeyqh.com, www.jmgryqh.com, www.jmryqh.com, www.jmgtyqh.com, www.jmtyqh.com, www.jmgbyqh.com, www.jmbyqh.com, www.jmgvyqh.com, www.jmvyqh.com, www.jmgqh.com, www.jmgyzqh.com, www.jmgzqh.com, www.jmgyaqh.com, www.jmgaqh.com, www.jmgysqh.com, www.jmgsqh.com, www.jmgydqh.com, www.jmgdqh.com, www.jmgyqh.com, www.jmgqh.com, www.jmgycqh.com, www.jmgcqh.com, www.jmgy qh.com, www.jmg qh.com, www.jmgyh.com, www.jmgyqeh.com, www.jmgyeh.com, www.jmgyqrh.com, www.jmgyrh.com, www.jmgyqvh.com, www.jmgyvh.com, www.jmgyqbh.com, www.jmgybh.com, www.jmgyqnh.com, www.jmgynh.com, www.jmgyqfh.com, www.jmgyfh.com, www.jmgyqgh.com, www.jmgygh.com, www.jmgyqhh.com, www.jmgyhh.com, www.jmgyqyh.com, www.jmgyyh.com, www.jmgyq.com, www.jmgyqhe.com, www.jmgyqe.com, www.jmgyqhd.com, www.jmgyqd.com, www.jmgyqhc.com, www.jmgyqc.com, www.jmgyqhu.com, www.jmgyqu.com, www.jmgyqhj.com, www.jmgyqj.com, www.jmgyqh.com, www.jmgyq.com, www.jmgyqhb.com, www.jmgyqb.com, www.jmgyqhg.com, www.jmgyqg.com,

    Other websites we recently analyzed

    1. Sandvig Studio | Art | Furniture |
      Dallas (United States) - 192.155.192.185
      Server software: Apache
      Technology: CSS, Font Awesome, Html, Iframe, Javascript, jQuery, Php, Pingback, Google Analytics, Wordpress
      Number of Javascript: 18
      Number of meta tags: 5
    2. Tax Forms
      Columbus (United States) - 50.6.15.187
      Server software: Apache
      Technology: Google Adsense, Html
      Number of Javascript: 1
      Number of meta tags: 1
    3. 기업건설정보
      디스크립션
      Korea, Republic of - 112.175.85.143
      Server software: nginx
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery UI, Php
      Number of Javascript: 6
      Number of meta tags: 3
    4. ifashion
      ifashion
      Lithuania - 79.98.25.28
      G Analytics ID: UA-53267986-1
      Server software: Apache
      Technology: Carousel, CSS, Html, Html5, Javascript, jQuery Colorbox, jQuery Cookie, jQuery UI, Php, Google Analytics
      Number of Javascript: 11
      Number of meta tags: 4
    5. Home - ATER Viterbo
      Azienda Territoriale per l’Edilizia Residenziale Pubblica della Provincia di Viterbo
      Arezzo (Italy) - 62.149.142.90
      Server software: Apache
      Technology: CSS, Html, Iframe, Javascript, jQuery, Php, Joomla
      Number of Javascript: 7
      Number of meta tags: 4
    6. tuckerbicycle
      Check out this GoDaddy hosted webpage! http://tuckerbicycle.com.
      Scottsdale (United States) - 97.74.42.79
      Server software: Microsoft-IIS/7.0
      Technology: CSS, Html, Javascript, jQuery, jQuery UI
      Number of Javascript: 4
      Number of meta tags: 3
    7. Lehigh Cottage
      Scottsdale (United States) - 97.74.141.128
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery
      Number of Javascript: 4
      Number of meta tags: 4
    8. MK MEDIA - Интернет-маркетинг
      MK MEDIA - Интернет-маркетинг
      Russian Federation - 77.222.56.94
      Server software: nginx/1.9.12
      Technology: CSS, Html, Html5, Javascript, LiveInternet counter
      Number of Javascript: 1
      Number of meta tags: 4
    9. Welcome to COLORADOSPRINGSCRIMINALDEFENSELAWYER.COM
      Scottsdale (United States) - 184.168.221.96
      Server software: Microsoft-IIS/7.5
      Technology: Google Adsense, CSS, Html, Javascript
      Number of Javascript: 3
      Number of meta tags: 2
    10. Home
      Brea (United States) - 69.163.144.16
      Server software: Apache
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 6
      Number of meta tags: 2

    Check Other Websites